RGAP LOCUS ID | LOC_Os06g09390 | ||||
RAP-DB ID | Os06g0194000 | ||||
Function | AP2 domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 10 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.688 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.74 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsERF71 | ||||
Function assigned as per literature | OsERF71 plays a positive role in drought stress tolerance by increasing the expression of genes associated with ABA signaling and proline biosynthesis under stress | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | N. benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 29576066 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945217308890?via%3Dihub | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 2 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.116 | ||||
NLS score | 0.15 | ||||
Protein Sequence | >LOC_Os06g09390.1 protein MCGGAILSDLIPPPRRVTAGDLWLEKTKKQQQQKKKNKGARRLPLRQEEEDDFEADFEEFEVDSGEWEVESDADEAKPLAAPRSGFAKGGLKNTTVAGAD GPAARSAKRKRKNQFRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDGAPVASQRSHAEPSSMNMPAFSIEEKPA VMSAGNKTMYNTNAYAYPAVEYTLQEPFVQIQNVSFVPAMNAIEDTFVNLSSDQGSNSFGCSDFSQENDIKTPDITSMLAPTMTGVDDSAFLQNNASDAM VPPVMGNASIDLADLEPYMKFLIDGGSDESIDTLLSSDGSQDVASSMDLWSFDDMPVSAEFY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |