 
    | RGAP LOCUS ID | LOC_Os06g06530 | ||||
| RAP-DB ID | Os06g0160400 | ||||
| Function | proline-rich cell wall protein-like, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | Nuclear | ||||
| score | 4 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 2.618 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.08 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Nuclear | ||||
| score | 79.87 | ||||
| confidence value | 0.13 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | HGW | ||||
| Function assigned as per literature | HGW Gene Encodes a Ubiquitin-Associated (UBA) Domain Protein That Regulates Heading Date and Grain Weight | ||||
| Subcellular localization as per literature | Cytosol and nucleus | ||||
| Cells used for localization experiment | Tobacco leaf and onion epidermal cells and rice protoplast | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 22457828 | ||||
| Reference of localization | http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0034231 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.082 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os06g06530.1 protein MDYDYRGRPGSGSYGGGVGGGGGSSSLYPRVGQPSHGVANAPPPEPPRAAPYHHHGPPTVSAAPHPVPASSSTSMGIQVVIKPAYRITPPPQLPPQLTEI PRSTFNFDFEYERKILAEAEKENPNWSKFVIESQPPPPPQPPRGPKLTTPTTSVATPGDPVVDKYISMGLGREAVSFAVLNYGDNPAKVKEFVKSYNALH EMGFTSSNVPELLAIHDNDPDKVIQHLIGTS | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| Presence of Splice variants | No | ||||