RGAP LOCUS ID | LOC_Os06g05190 | ||||
RAP-DB ID | Os06g0144000 | ||||
Function | BRCA1 C Terminus domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.42 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.66 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 1 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsXRCC1 | ||||
Function assigned as per literature | OsXRCC1 contributes to DNA repair pathways | ||||
Subcellular localization as per literature | nucleus | ||||
Cells used for localization experiment | onion epidermis cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 18247046 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs00425-008-0695-3 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 2 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.147 | ||||
NLS score | 0.49 | ||||
Protein Sequence | >LOC_Os06g05190.1 protein MPESSSDPNNGRGKSSKRNLPSWMGSKDGEENPGKKKHMATHEKVQKGSDFSKLLDGVVFVLSGFVNPERGTLRSQALDMGAEYRPDWTSDCTLLVCAFA NTPKFRQVESNNGTIVSKDWILESHSQRKLVDIEPYLMHVGKPWRKNKELVESDEDQKKPHKEHQKQVDRSHIKTSPSAGIEAKHSDVTSKQFSPTKIKQ WAKNDLAQTISWLESQEEKPEPNELKAIAAEGVITCLQDAIESLKQGNDVKGVAEQWSFVPHVINELAELDGRRKEGSLSKEQLSQLAIKCKKIYQAEFA HMHDNDKKHQSKPRSDDAQYDSDDTIEMTEEEIDLACRQLPGVCGRQ |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |