LOC_Os06g05120
| RGAP LOCUS ID | LOC_Os06g05120 |
| RAP-DB ID | Os06g0143100 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | mito |
| score | 10 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 1.394 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.03 |
4) Y-Loc Prediction |
|
| localization | Secreted pathw |
| score | |
| confidence value | 0.37 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsCDT1|OsCDT2 |
| Function assigned as per literature | OsCDT1 enhances tolerance to cadmium by limiting its cellular accumulation |
| Subcellular localization as per literature | Cytoplasmic membranes and cell walls |
| Cells used for localization experiment | Rice leaf sheath cells and onion cells |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 19017626 |
| Reference of localization | https://academic.oup.com/pcp/article/50/1/106/1850439 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.055 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os06g05120.2 protein MYNAPMAQDMSYYEHVQRRHEEKGCLYACIFTALCCFCCYETCECCLDCLCCCCN |
GO Analysis |
|
| Presence of Splice variants | YES |