RGAP LOCUS ID | LOC_Os06g05010 | ||||
RAP-DB ID | Os06g0142350 | ||||
Function | early nodulin 93 ENOD93 protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | mito | ||||
score | 7.5 | ||||
2) CELLO Prediction |
|||||
localization | Mitochondrial | ||||
score | 1.639 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.13 | ||||
4) Y-Loc Prediction |
|||||
localization | Mitochondrion | ||||
score | |||||
confidence value | 0.28 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsENOD93-1 | ||||
Function assigned as per literature | |||||
Subcellular localization as per literature | Mitochondria | ||||
Cells used for localization experiment | Onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 19682292 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-3040.2009.02032.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.129 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os06g05010.1 protein MSTTVTRAHLEQRLALAKRCSREANLAGVKAAAVATIASAVPTLASVRMLPWAKANINPTGQALIICTAAGMAYFVAADKKILSLARRHSFENAPEHLKN TSFQGTGRPHPAFFRP |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | YES |