RGAP LOCUS ID | LOC_Os06g04710 |
RAP-DB ID | Os06g0139000 |
Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
localization | chlo |
score | 11 |
2) CELLO Prediction |
|
localization | PlasmaMembrane |
score | 1.881 |
3) NUCPRED Prediction |
|
localization | Non Nuclear |
score | 0.29 |
4) Y-Loc Prediction |
|
localization | Mitochondrion |
score | |
confidence value | 0.34 |
Number Of Software Predicting Nucleus | 0 |
Seed Specific | No |
Transcription factor category | |
Experimental evidence for subcellular localization |
|
Published gene name (updated 1 January 2020) | DDF1 |
Function assigned as per literature | DDF1, is a newly identified F-box gene, is a crucial genetic factor with pleiotropic functions for both vegetative growth and floral organ specification in rice |
Subcellular localization as per literature | Nucleus |
Cells used for localization experiment | Onion epidermal cells |
NUCLEAR or Not Nuclear | NUCLEAR |
PMID | 22897567 |
Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-313X.2012.05126.x |
Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
Number of PAT4 | 0 |
Number of PAT7 | 0 |
Number of Bipartite | 0 |
Basic residues % | 0.11 |
NLS score | -0.47 |
Protein Sequence | >LOC_Os06g04710.1 protein MPMRDAARAACVSHSFLSSWRCHPNLNFSSEALGLSKNAYGNEELAGLFYSKVNHILKRHSGIGVKKLTIKVYSDYSGKGSSYLNNWLQIAVKPGIEELI IALTQFQAKYNFPCSLLSNGSGDSIQYLHLSNCSFHPTVTLSGLRSLTRLYLCRVRITENELGCLLSHSLALEQLEIRYCNRIVCLKVPCLLQRLISLKV FGCDKLKLIENEAPNVSMFAFQGDKTELKLGETLQIKSLCMVRSGYVYHARAELPSIMPNLESLALKSCKETAFAPKLCSKFLCLRHLSIGLIGFFPAYD YLSLASYIYAAPSLETFDLNVMQRNVQSVSIFAHPADLRSIREEKHHNLKSVTVTSFISVKSLVELTCHILESTASLECLTLDASQTGFRCDTPGSKISK CPPLDRDIIMEGHRGVLAIRRYIQPRVPSTVKLTVLEPCSCHSTEL |
GO Analysis |
|
Presence of Splice variants | No |