RGAP LOCUS ID | LOC_Os06g04500 | ||||
RAP-DB ID | Os06g0136500 | ||||
Function | cornichon protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 4.846 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.25 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.75 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsCNIH1 | ||||
Function assigned as per literature | OsCNIH1 interacts with OsHKT1;3 and enables the expression of the sodium transporter to the Golgi apparatus | ||||
Subcellular localization as per literature | OsCNIH1 Iis colocalized withOsHKT1;3 in plasma membrane | ||||
Cells used for localization experiment | tobacco leaves | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 25750424 | ||||
Reference of localization | https://academic.oup.com/jxb/article/66/9/2733/679229 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.074 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os06g04500.1 protein MVFVWLTAFFLVVALIVLVIYQLMCLADLEFDYINPFDSSSRINKVVIPEFVLQAALSVLFLLSGHWAMFLLSAPMVYYNYTLYQRRQHLVDVTEIFNHL GREKKRRLFKIVGLIILLFLSLFWMIWTVLLEEDE |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | YES |