| RGAP LOCUS ID | LOC_Os06g01850 | 
                        
                            | RAP-DB ID | Os06g0107700 | 
                        
                            | Function | ferredoxin--NADP reductase, chloroplast precursor, putative, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | chlo | 
                        
                            | score | 11 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | Chloroplast | 
                        
                            | score | 3.489 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.04 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Chloroplast | 
                        
                            | score | 9 | 
                        
                            | confidence value | 0.93 | 
                        
                            | Number Of Software Predicting Nucleus | 0 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category |  | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | OsLFNR2|LFNR2 | 
                        
                            | Function assigned as per literature | LFNR2 interacts with LIR1 | 
                        
                            | Subcellular localization as per literature | OsLFNR2|LFNR2 colocalize with LIR1 in chloroplast | 
                        
                            | Cells used for localization experiment | tobacco mesophyll protoplasts | 
                        
                            | NUCLEAR or Not Nuclear | NOT NUCLEAR | 
                        
                            | PMID | 26941088 | 
                        
                            | Reference of localization | http://www.plantcell.org/content/28/3/712.long | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 0 | 
                        
                            | Number of PAT7 | 1 | 
                        
                            | Number of Bipartite | 0 | 
                        
                            | Basic residues % | 0.138 | 
                        
                            | NLS score | -0.13 | 
                        
                            | Protein Sequence | >LOC_Os06g01850.1 protein MAAVTAAAVSTSAAAAVTKASPSPAHCFLPCPPRTRAAHQRGLLLRAQVSTTDAAAVAAAPAKKEKISKKHDEGVVTNKYRPKEPYVGKCLLNTKITADD
 APGETWHMVFSTEGEIPYREGQSIGVIADGVDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEIVKGVCSNFLCDLKPGSDVKITGPVG
 KEMLMPKDPNANIIMLATGTGIAPFRSFLWKMFFEKYDDYKFNGLAWLFLGVPTSSSLLYKEEFDKMKAKAPENFRVDYAVSREQTNAQGEKMYIQTRMA
 EYKEELWELLKKDHTYVYMCGLKGMEKGIDDIMVSLAAKDGIDWADYKKQLKKGEQWNVEVY
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | extracellular region |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to stress |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to biotic stimulus |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | membrane |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | plastid |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | thylakoid |  | 
                                                                
                                    | 7 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | metabolic process |  | 
                                                                
                                    | 8 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | RNA binding |  | 
                                                                
                                    | 9 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | catalytic activity |  | 
                                                        
                            | Presence of Splice variants | No |