RGAP LOCUS ID | LOC_Os05g51820 | ||||
RAP-DB ID | Os05g0597000 | ||||
Function | helix-loop-helix DNA-binding protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 5.5 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.661 | ||||
3) NUCPRED Prediction |
|||||
localization | Nuclear | ||||
score | 0.83 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.97 | ||||
confidence value | 0.95 | ||||
Number Of Software Predicting Nucleus | 4 | ||||
Seed Specific | No | ||||
Transcription factor category | bHLH | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsMUTE | ||||
Function assigned as per literature | OsMUTE has role in stomatal developmental stage in rice | ||||
Subcellular localization as per literature | OsMUTE interacted with OsICE1 and OsICE2 in nucleus | ||||
Cells used for localization experiment | epidermal cells of Nicotiana benthamiana (tobacco) leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30825332 | ||||
Reference of localization | https://nph.onlinelibrary.wiley.com/doi/pdf/10.1111/nph.15766 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.097 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os05g51820.1 protein MSHIAVERNRRRQMNDHLKVLRSLTPAFYIKRGDQASIIGGAIDFIKELQTLLQSLEAQKKRRQQPQAHLISPASISASGGGSPSPTPSPRSLITSCSPT AAAGSSAGSSSSISPKDENKQQLQLVAELAACCNSPMADVEARISGANVLLRTLSRRAPPVRIIALLESLHLEVLHLNITTMDDTVLYSFVLKIGLDCHL SVDDLAMEVHQSFMPPPAAHPDNHLHS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |