| RGAP LOCUS ID | LOC_Os05g51690 | ||||
| RAP-DB ID | Os05g0595300 | ||||
| Function | CCT motif family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 8.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.235 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.68 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 0.98 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | Orphans | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | NRR|CRCT | ||||
| Function assigned as per literature | NRR compromises Xa21-mediated resistance indicates cross-talk or overlap between NH1- and Xa21-mediated pathways | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 16115061 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/j.1365-313X.2005.02485.x | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.117 | ||||
| NLS score | 0.09 | ||||
| Protein Sequence | >LOC_Os05g51690.1 protein MYAAMYPETFGFSAYPQQQQPPPDAASCIYTTALPLIADPPDILGNMAQPSFLSEYDLGGEGDLFKAPEPIIEEPVLSLDPVAAAISMMSGSENVMDETI EVADISDIQNDSLLSEVLYECEKELMEKSAIEETISELLDVKIPMLQVEEFPRETQVQLPAMEKEKPSVPECCSLQKSVSSGCLNSADWINGPARPNFLD FQGLDFETAFGLRRAYSEGDIQNLGASTPRPGNSGNAQLASCERLVTISDLKSEERKQKLSRYRKKKVKRNFGRKIKYACRKALADSQPRVRGRFAKIEE GDLLKPRK |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||