| RGAP LOCUS ID | LOC_Os05g51420 | ||||
| RAP-DB ID | Os05g0591900 | ||||
| Function | hypersensitive-induced response protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | cyto | ||||
| score | 10 | ||||
2) CELLO Prediction |
|||||
| localization | Cytoplasmic | ||||
| score | 1.726 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.1 | ||||
4) Y-Loc Prediction |
|||||
| localization | Cytoplasm | ||||
| score | 82 | ||||
| confidence value | 0.79 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsHIR3 | ||||
| Function assigned as per literature | OsHIR3 is required for cell death by oxidative stress and salicylic acid | ||||
| Subcellular localization as per literature | Plasma membrane | ||||
| Cells used for localization experiment | onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26297139 | ||||
| Reference of localization | http://www.plantphysiol.org/content/plantphysiol/early/2015/08/21/pp.15.00445.full.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.115 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os05g51420.1 protein MMYEHSGTAGSYLRTAAMGNLFCCVQVDQSTVAIREQFGKFDAVLEPGCHCLPWFAGKRIAGHLTLRLQQLDVRCETKTKDNVFVNVVASIQYRALAGKA NDAFYKLSNTRSQIQAYVFDVIRASVPKLNLDDAFEQKNDIAKAVEDELEKAMSAYGFEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKI VQIKRAEGEAEAKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTTAKDVMDMVLITQYFDTMKEIGASSKASSVFIPHGPGAVRDIATQIRDGLLQGQA TTTSH |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| 7 |
|
||||
| Presence of Splice variants | YES | ||||