RGAP LOCUS ID | LOC_Os05g51060 | ||||
RAP-DB ID | Os05g0588200 | ||||
Function | DNA ligase, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 1.104 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.16 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 3 | ||||
confidence value | 0.13 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsPTD1 | ||||
Function assigned as per literature | OsPTD1 along with OsSHOC1 is essential for rice fertility and CO formation, possibly by stabilizing the recombinant intermediates during meiosis | ||||
Subcellular localization as per literature | Nucleus, cytoplasm, and plasma membrane | ||||
Cells used for localization experiment | rice protoplasts and in tobacco epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30589140 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/pdf/10.1111/tpj.14214 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.109 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os05g51060.1 protein MERSTHSTGWTCLPPPPPEPAAPGRGVCAMSTSWRDKQQPSLINFIAAFLAANSYRLNFLSISPDFIFNNGELSVAFIFETNWDCQNEGAVFSRVNMLKR QLKHLYVVVAVPTKEQNESFNRSYHKYGMKLGFPTFVPVTDPEMGFEKIVKIAHALGVCKQQDIISRLKNEREQAVQCTDSFLRVLTSIPGIDNHDANAL AQAIGSIEAIAKASKKFILENTDLSTDKAETIVRFFRDPQYYLSPKIN |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | No |