| RGAP LOCUS ID | LOC_Os05g49940 | ||||
| RAP-DB ID | Os05g0575000 | ||||
| Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 12 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.294 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.39 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 6 | ||||
| confidence value | 0.07 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsCV | ||||
| Function assigned as per literature | OsCV-mediated chloroplast degradation pathway is involved in the regulation of nitrogen assimilation during stress-induced plant senescence | ||||
| Subcellular localization as per literature | Chloroplast,pre-vacuolar compartment and vacoule | ||||
| Cells used for localization experiment | Nicotiana benthamiana cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 28992306 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/69/4/867/4037382 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.1 | ||||
| NLS score | -0.13 | ||||
| Protein Sequence | >LOC_Os05g49940.1 protein MVVSCQLKPAPAPAAASRGGGAPHLQQLRRACVAAAAACAVLGTAGGPGEGAVMARAPEATAAAAAGPARWSDRRQCPPWRANSLENIVPENLPRPSARR RFNSITAAAAAESAPPPASASPDAVLPFLAPRSGMGCFSL |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | No | ||||