RGAP LOCUS ID | LOC_Os05g49940 | ||||
RAP-DB ID | Os05g0575000 | ||||
Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 12 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.294 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.39 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 6 | ||||
confidence value | 0.07 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsCV | ||||
Function assigned as per literature | OsCV-mediated chloroplast degradation pathway is involved in the regulation of nitrogen assimilation during stress-induced plant senescence | ||||
Subcellular localization as per literature | Chloroplast,pre-vacuolar compartment and vacoule | ||||
Cells used for localization experiment | Nicotiana benthamiana cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 28992306 | ||||
Reference of localization | https://academic.oup.com/jxb/article/69/4/867/4037382 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.1 | ||||
NLS score | -0.13 | ||||
Protein Sequence | >LOC_Os05g49940.1 protein MVVSCQLKPAPAPAAASRGGGAPHLQQLRRACVAAAAACAVLGTAGGPGEGAVMARAPEATAAAAAGPARWSDRRQCPPWRANSLENIVPENLPRPSARR RFNSITAAAAAESAPPPASASPDAVLPFLAPRSGMGCFSL |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |