RGAP LOCUS ID | LOC_Os05g45280 | ||||
RAP-DB ID | Os05g0529000 | ||||
Function | protein of unknown function DUF502 domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 5 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 4.18 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.07 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 71 | ||||
confidence value | 0.42 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsCOLE1 | ||||
Function assigned as per literature | OsCOLE1 regulates intracellular auxin transport and plays role in rice development | ||||
Subcellular localization as per literature | Tonoplast | ||||
Cells used for localization experiment | Rice mesophyll cell protoplasts and tobacco leaves | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 27265035 | ||||
Reference of localization | https://nph.onlinelibrary.wiley.com/doi/full/10.1111/nph.14021 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.084 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os05g45280.1 protein MGDEKSPLSQMGSRDRDRELLIPVSGGGSAPGDGDGDGDRAASSSASAALSSSSREAFHKVVRSWASKKFMTGCVILFPIAITFYITWWFIHFVDGFFSP IYAQLGINMFGLGFITSVTFIFVVGVFMSSWVGASVLSLGEWIIKRMPLVRHIYNASKQISAAISPDQNKQAFKEVVIIRHPRIGEYAFGFITSSVSLQS YTGQEELYCVYVPTNHLYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPQTILGDRTGASRS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |