| RGAP LOCUS ID | LOC_Os05g41080 | ||||
| RAP-DB ID | Os05g0489800 | ||||
| Function | histone H3, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.251 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.68 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 90.17 | ||||
| confidence value | 0.23 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | CENH3 | ||||
| Function assigned as per literature | CENH3 is a key element of a functional centromere that can be used as an identification marker for functional centromeric chromatin | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Somatic chromosomes at mitosis prometaphase in variant YZG-5 | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 28577021 | ||||
| Reference of localization | https://www.nature.com/articles/s41598-017-02796-9 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 2 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.206 | ||||
| NLS score | 1.42 | ||||
| Protein Sequence | >LOC_Os05g41080.1 protein MARTKHPAVRKSKAEPKKKLQFERSPRPSKAQRAGGGTGTSATTRSAAGTSASAGTPRQQTKQRKPHRFRPGTVALREIRKFQKTTELLIPFAPFSRLVR EITDFYSKDVSRWTLEALLALQEAAEYHLVDIFEVSNLCAIHAKRVTIMQKDMQLARRIGGRRPW |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | YES | ||||