RGAP LOCUS ID | LOC_Os05g41080 | ||||
RAP-DB ID | Os05g0489800 | ||||
Function | histone H3, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.251 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.68 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 90.17 | ||||
confidence value | 0.23 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | CENH3 | ||||
Function assigned as per literature | CENH3 is a key element of a functional centromere that can be used as an identification marker for functional centromeric chromatin | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Somatic chromosomes at mitosis prometaphase in variant YZG-5 | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 28577021 | ||||
Reference of localization | https://www.nature.com/articles/s41598-017-02796-9 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 2 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.206 | ||||
NLS score | 1.42 | ||||
Protein Sequence | >LOC_Os05g41080.1 protein MARTKHPAVRKSKAEPKKKLQFERSPRPSKAQRAGGGTGTSATTRSAAGTSASAGTPRQQTKQRKPHRFRPGTVALREIRKFQKTTELLIPFAPFSRLVR EITDFYSKDVSRWTLEALLALQEAAEYHLVDIFEVSNLCAIHAKRVTIMQKDMQLARRIGGRRPW |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | YES |