RGAP LOCUS ID | LOC_Os05g40980 | ||||
RAP-DB ID | Os05g0488800 | ||||
Function | zinc finger, C3HC4 type domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 12 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.631 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.3 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 98.57 | ||||
confidence value | 0.98 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsSIRP1 | ||||
Function assigned as per literature | OsSIRP1 acts as a negative regulator of salinity stress tolerance mediated by the ubiquitin 26S proteasome system | ||||
Subcellular localization as per literature | Cytoplasm | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 27118216 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/ppl.12459 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 2 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.074 | ||||
NLS score | -0.1 | ||||
Protein Sequence | >LOC_Os05g40980.1 protein MAEAAITRYWCHECEQAIEEAMVDEIKCPSCGGGFVEEMTDEEIERLTNRQPEPGFSQWNPIEHPGETMDSDDEDNDLGREFEGFIRRHRRASTLRRVLD SIHDDLADDQERDSSILINAFNQALALQGSVLDPDEGQGDQGGSTNDDGLLEEYVLGAGLSLLLQHLAESDPSRNGTPPAKKEAVEALPTVKIEEVVSCS VCLDDLEVGSQAKQMPCEHKFHSSCILPWLELHSSCPVCRFELPSEETKDLNEPSNIGRVEDSHEEVRADGPGNVSESSNRPWAIVPWLNELFSTREAQN AGGVSTDQQSPHTSGTNPNAGHS |
||||
GO Analysis |
|||||
1 |
|
||||
Presence of Splice variants | YES |