| RGAP LOCUS ID | LOC_Os05g39670 | ||||
| RAP-DB ID | Os05g0474400 | ||||
| Function | prenylated rab acceptor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 11 | ||||
2) CELLO Prediction |
|||||
| localization | PlasmaMembrane | ||||
| score | 3.955 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.12 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 9 | ||||
| confidence value | 0.38 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsPRA1 | ||||
| Function assigned as per literature | OsPRA1 may function as a Rab effector for vacuolar trafficking in the plant system. | ||||
| Subcellular localization as per literature | PVC | ||||
| Cells used for localization experiment | Arabidopsis protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | not available | ||||
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945209001939 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.077 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os05g39670.1 protein MASSAPTPPPLLPVTNPAAAGSSPAATAVGSDAPIATPAFRLFLSKLSDSARRSLSDRRPWTELVDRSAFSRPDSLSDATSRLRRNLAYFRVNYAAVVAF ALGASLLAHPFSLLVLLGLLAAWCFLYLFRGSDQPVVLFGRTFSDRETLLGLVVASFVAFFFTSVASLIISGLLVGGAIVAVHGACRMPEDLFLDDADAA SGNSAAQGLLSFLGAPGSRV |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | No | ||||