RGAP LOCUS ID | LOC_Os05g36070 | ||||
RAP-DB ID | Os05g0436400 | ||||
Function | signal peptide peptidase domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 8 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 4.935 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.01 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 8 | ||||
confidence value | 0.53 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsSPP2 | ||||
Function assigned as per literature | Rice SPPs have an important function in differentiation and development at the shoot apex | ||||
Subcellular localization as per literature | ER | ||||
Cells used for localization experiment | Arabidopsis suspension-cultured cell line | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 19688213 | ||||
Reference of localization | https://link.springer.com/article/10.1007/s00299-009-0760-9 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.087 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os05g36070.2 protein MKTHERAANLALAGLSLAPLVVKVNPNANVILTACLAVYVGCYRSVKPTPPAETMSKEHAMRFPLVGSAMLLSLFLLFKFLSKDLVNTVLTAYFFILGIA ALCATLLPSIKRFLPKEWNDNAIVWRAPLFHSLSVEFTRSQVVASIPGFFFCIWYAAKKHWLANNVLGISFCIQGIEMLSLGSFKTGAILLSGLFFYDIF WVFFTPVMVSVAKSFDAPIKLLFPTGDAARPFSMLGLGDIVIPGIFVALALRFDVSRGIKNRYFNSAFLGYTVGLTVTIIVMNWFQAAQPALLYIVPGVI GFVAVHCLWNGEVKPLLEYNESKAEEEEACEEDTDSKQNKKKE |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | YES |