LOC_Os05g16250
| RGAP LOCUS ID | LOC_Os05g16250 | ||||
| RAP-DB ID | Os05g0251400 | ||||
| Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 7 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.235 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.7 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 71.13 | ||||
| confidence value | 0.22 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | P31comet|OsBVF1 | ||||
| Function assigned as per literature | OsBVF1 is a novel plant-conserved factor involved in meiotic recombination in rice, providing a new insight into understanding of meiotic progression regulation | ||||
| Subcellular localization as per literature | nucleus | ||||
| Cells used for localization experiment | rice protoplasts, | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 28369589 | ||||
| Reference of localization | https://www.ncbi.nlm.nih.gov/pubmed/28369589 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.133 | ||||
| NLS score | 0.02 | ||||
| Protein Sequence | >LOC_Os05g16250.1 protein MERATTSGGGGGGSQPPRGVGLPLVEVQAAAASLRRSEVFYVVKELLGFVLYMHHQIPAVLQNLENEFASLKEEMTEMALPPGEMKPSDQRKYNTRKREV RRRIKKQEKLMNGLSSVFSALQKALDEVPSIEGVLLILGGSLVRPLFVYDITISHGRFDAGSANERGASKLAQSVSRKAIRALISSGAGSLSYTGPTKLF VLVRCPCTLNLPLDFLPKRDFRYSKKVVPLQMCIKCNIAGIQIDNQQITSIVDASRCTSESTISEVIWFQCKHTIRGLPCKASLEE |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | No | ||||