RGAP LOCUS ID | LOC_Os05g10670 | ||||
RAP-DB ID | Os05g0195101 | ||||
Function | zinc finger CCCH type family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 12 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.101 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.79 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 77.21 | ||||
confidence value | 0.12 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | C3H | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsTZF1 | ||||
Function assigned as per literature | OsTZF1 functions in phytochrome-mediated light and ABA responses in rice | ||||
Subcellular localization as per literature | Cytoplasm | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 22572927 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs00299-012-1252-x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.125 | ||||
NLS score | 0.1 | ||||
Protein Sequence | >LOC_Os05g10670.1 protein MVRKRRDTARVNPTAVSGGGLSGLYSRASSSPPLHHSGSRRRLRTNTLPRRSWRRGEELESKMMMMGEGAHAPPWQQHVASPVSGVEGGGGRESEVVAAP YHLLDTLRHYLPSNEAAAAEDEEEAAAVAAAVDAYACDEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDFRKGGCKRGDACE FAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVLPPSQQQGSNSPRGCGGGGAGAAASPLAESYDGSPLRRQAFESYLTKSIMSSSPTSTL VSPPRSPPSESPPLSPDAAGALRRGAWAGVGSPVNDVHVSLRQLRLGSPRSAPSCASFLPAGYQYGSPKSPAAAAAAALYSLPSTPTRLSPVTVTTASGA TVTVEPLDLGLIEEEQPMERVESGRALREKVFERLSKEATVSTDAAAAAAGVAPDVGWVSDLIN |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |