| RGAP LOCUS ID | LOC_Os05g06720 | 
                        
                            | RAP-DB ID | Os05g0159300 | 
                        
                            | Function | GDSL-like lipase/acylhydrolase, putative, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | cyto | 
                        
                            | score | 9 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 1.372 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.02 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Cytoplasm | 
                        
                            | score | 78 | 
                        
                            | confidence value | 0.55 | 
                        
                            | Number Of Software Predicting Nucleus | 1 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category |  | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | DARX1 | 
                        
                            | Function assigned as per literature | DARX1 modulates the arabinoxylan acetylation profile and secondary wall formation | 
                        
                            | Subcellular localization as per literature | Golgi apparatus | 
                        
                            | Cells used for localization experiment | Rice protoplasts | 
                        
                            | NUCLEAR or Not Nuclear | NOT NUCLEAR | 
                        
                            | PMID | 30886126 | 
                        
                            | Reference of localization | http://www.plantcell.org/content/31/5/1113.long | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 1 | 
                        
                            | Number of PAT7 | 1 | 
                        
                            | Number of Bipartite | 0 | 
                        
                            | Basic residues % | 0.147 | 
                        
                            | NLS score | 0.21 | 
                        
                            | Protein Sequence | >LOC_Os05g06720.2 protein MDIGHNDLMGVLHLSYDEILRKLPPIVAEIRKAIETLHKNGAKKFWIHGTGALGCLPQKLATRGEIDRDLDEHGCITRINNVAKRFNKLLSETCDDLRLQ
 FASSTIVFVDMFAIKYDLVANHTKHGIEKPLMTCCGHGGPPYNYDPKKSCTANDKDLCKLGEKFISWDGVHFTDAANEIVASKVISGEFSIPRIKLTASV
 VRPKKAKNSRL
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | metabolic process |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | hydrolase activity |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biosynthetic process |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | carbohydrate metabolic process |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | generation of precursor metabolites and energy |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | lipid metabolic process |  | 
                                                                
                                    | 7 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | plastid |  | 
                                                        
                            | Presence of Splice variants | YES |