| RGAP LOCUS ID | LOC_Os05g06270 | ||||
| RAP-DB ID | Os05g0154600 | ||||
| Function | zinc finger, C3HC4 type domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 6 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.951 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.37 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 80.52 | ||||
| confidence value | 0.95 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | APIP6 | ||||
| Function assigned as per literature | APIP6 Is a RING Finger E3 Ubiquitin Ligase and functions positively in PAMP-triggered immunity in rice | ||||
| Subcellular localization as per literature | Entire cells with more accumulation in the nucleus | ||||
| Cells used for localization experiment | Nicotiana benthamiana | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 23204406 | ||||
| Reference of localization | http://www.plantcell.org/content/24/11/4748.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.075 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os05g06270.1 protein MGAREEVREEEGEEGEGVGGKEEEKAAAAAAAVSCSICLDAVVAAGGERSTARLQCGHEFHLDCIGSAFNAKGVMQCPNCRKIEKGNWLYANGSRPTQDV NMDEWAHDEDLYDVSYSEMPFRFHWCPFGRLAQLPSFFEEGESSPPVTFHDFMGQHMFTEHVAAVSSAPGAAHPCPYVAYLHPLPSLASSSSSHVPERTM DGPAYHDPWHPLAGPSDGRPLQSVQPADFHHNHWAHVPNSYPQPNNNNGVAEQQGVPFGTTRAARVDGDTQRRGSSISPSYFSNGSGSRSRAPNVPPMVP QFMRAHGSISEQYQQSSSSSLFAGAHRSGGMRTAPPPPLPENPAFCLFPPGSSGHNSMETDDAGGNRFYAWERDRFAPYPLMPVDCETNWWSSQQSHGTS EPAPAPRRLFGQWIGVGRSSPENRSPEGSSYRQMHTPRM |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||