 
    | RGAP LOCUS ID | LOC_Os05g03884 | ||||
| RAP-DB ID | Os05g0129700 | ||||
| Function | homeobox protein knotted-1-like 6, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | Nuclear | ||||
| score | 13 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 3.248 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.66 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 0.98 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | HB/TALE | ||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OSH71|Oskn2 | ||||
| Function assigned as per literature | OSH71 play role in shoot meristem development in rice | ||||
| Subcellular localization as per literature | Nucleus and in cell wall aligned cytoplasm or cytoplasmic strands | ||||
| Cells used for localization experiment | Onion epidermal peels, Rice suspension cells, Rice epidermal leaf cells and root hairs of stably transformed Arabidopsis seedlings | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 15604716 | ||||
| Reference of localization | https://link.springer.com/article/10.1007/s11103-004-1967-3 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 3 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.106 | ||||
| NLS score | 0.34 | ||||
| Protein Sequence | >LOC_Os05g03884.1 protein MEDLYSIHPGISRGGGGGGGGAASEASGVAGGGSSPPHPPPPATTAAAADLTELMKAQIAGHPSYPSLLSAYIECRKVGAPPEVTTLLEEIGREGRGGGG GATAGGEIGLDPELDEFMETYCRVLERYKEELTRPFDEAASFLTGIHTQLASLCGGAPPPTDNSDEMVGSSEDEPCSGDADAADFGQEHSSRLADHELKE MLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKPSEDMRFALMEGVTGGSSSGT TLYFDTGTIGP | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| 5 | 
 | ||||
| 6 | 
 | ||||
| 7 | 
 | ||||
| Presence of Splice variants | No | ||||