 
    | RGAP LOCUS ID | LOC_Os05g03860 | ||||
| RAP-DB ID | Os05g0129300 | ||||
| Function | CPuORF3 - conserved peptide uORF-containing transcript, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | Nuclear | ||||
| score | 14 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 2.33 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Nuclear | ||||
| score | 0.83 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Nuclear | ||||
| score | 99.96 | ||||
| confidence value | 0.71 | ||||
| Number Of Software Predicting Nucleus | 4 | ||||
| Seed Specific | No | ||||
| Transcription factor category | bZIP | ||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | LIP19|OsbZIP38 | ||||
| Function assigned as per literature | Role in low-temperature signal switching | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | onion epidermal cells. | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 16051676 | ||||
| Reference of localization | https://academic.oup.com/pcp/article/46/10/1623/1904223 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 4 | ||||
| Basic residues % | 0.142 | ||||
| NLS score | 2.13 | ||||
| Protein Sequence | >LOC_Os05g03860.1 protein MSSPSRRSSSPESNTSGGGGGADERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGENAVLRARHGELAGRLQAL GSVLEILQVAGAPVDIPEIPDDPLLRPWQPPFAAQPIVATAMADAFQF | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| 5 | 
 | ||||
| Presence of Splice variants | No | ||||