RGAP LOCUS ID | LOC_Os04g57810 | ||||
RAP-DB ID | Os04g0674400 | ||||
Function | GA18008-PA, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 7 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 1.459 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.03 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 92 | ||||
confidence value | 0.58 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsDRE2 | ||||
Function assigned as per literature | OsDRE2 plays a positive role in the regulation of rice immunity | ||||
Subcellular localization as per literature | Cytoplasm but interacts with OsRLCK185 at plasma membrane | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 30418086 | ||||
Reference of localization | https://www.tandfonline.com/doi/abs/10.1080/09168451.2018.1543012?journalCode=tbbb20 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.106 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os04g57810.1 protein MAATVAEALAVTDELALPLRAVGDLAAAAGVSREEVVVITQCASLGGKLPFDDASVGSVLAVIKKVENLGDLFITEISRVLKAGGMVLIQSSPSDQDPNN SIQRKLLLGGFVDVQASAASSQDSEHSVTIKAKKVSWSLGSSFPLKKATKGLPKIQIDDDSELIDEDSLLTEDDLKKPELPVVGDCEVGATRKACKNCTC GRAEAEEKVEKLNLTSEQINNPQSACGNCGLGDAFRCGTCPYRGLPAFKPGEKIALPGNFLAADM |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | YES |