LOC_Os04g55920
| RGAP LOCUS ID | LOC_Os04g55920 | ||||
| RAP-DB ID | Os04g0653000 | ||||
| Function | zinc-finger protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.653 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.45 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 93.1 | ||||
| confidence value | 0.87 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | Tify | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsJAZ1|OsTIFY3|EG2 | ||||
| Function assigned as per literature | OsJAZ1 plays a negative role in drought resistance, partially through regulation of the JA and ABA pathways | ||||
| Subcellular localization as per literature | cytoplasmic in absence of exogenous MeJA, but moves to nucleus on treatment with 100 μM MeJA | ||||
| Cells used for localization experiment | rice protoplast | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 29312378 | ||||
| Reference of localization | https://www.frontiersin.org/articles/10.3389/fpls.2017.02108/full | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.12 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os04g55920.1 protein MDLLEKKNIKKGGEVEEEVARKGEERKEEEVVVEEKSHQQQQQQGEEELVGLSLAGGRPKVFPMSSPPPNPSQLTIFYGGSVCVYDSVPPEKAQAIMLIA AAAAAAASATKSNAAIAVKPPVMPAANATQAAVSPVLTRSLSLQSTSVATGQPQVAADPSSICKLQADLPIARRHSLQRFLEKRRDSRLVSKAPYPTKSS EGMEASGMEVTAEGKAQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | YES | ||||