| RGAP LOCUS ID | LOC_Os04g46220 | ||||
| RAP-DB ID | Os04g0546800 | ||||
| Function | ethylene-responsive transcription factor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 11 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.205 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.58 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 1 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsERF1 | ||||
| Function assigned as per literature | OsERF1 is involved in ethylene response | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Onion peel cells and root tip cells of transgenic Arabidopsis | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 18313797 | ||||
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S0176161707003380?via%3Dihub#fig2 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 3 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.094 | ||||
| NLS score | 0.84 | ||||
| Protein Sequence | >LOC_Os04g46220.1 protein MTARSMLRNHPEASVLDTIRQHLLEEPRGGGGGEAAEASFGSLVADMWSDSLPFRDDDADDMVVFGAMRDAFSCGWLPDGVFAEVKPEPLLSPDSSSYDG SSCCFGFADVSEPVTPSDAASGAAEAAAAAAAATAEHGKEEEAAAAVARGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFDTAEDAALAYDRAAYRM RGSRALLNFPLRIGSEIAAAAAAAAAAAAGDKRPSPEPATSESSFSSSSSCTTTTTSSSTSSSGSPKRRKRGEAAAASMSMPLVPPPSQLNWPVQAWYPA AAPVEQVAITPRVEQLVI |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| 7 |
|
||||
| Presence of Splice variants | No | ||||