| RGAP LOCUS ID | LOC_Os04g42000 | ||||
| RAP-DB ID | Os04g0497400 | ||||
| Function | 6,7-dimethyl-8-ribityllumazine synthase, chloroplast precursor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 3.538 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.01 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 1 | ||||
| confidence value | 0.99 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsLS | ||||
| Function assigned as per literature | OsLS has role in defense responses. | ||||
| Subcellular localization as per literature | Chloroplast | ||||
| Cells used for localization experiment | transgenic tobacco (LSETT) lines | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 20465413 | ||||
| Reference of localization | https://apsjournals.apsnet.org/doi/pdf/10.1094/PHYTO-100-6-0573 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.086 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os04g42000.1 protein MAAAAPATTSSAAARPSSSSSSSRQSDAPLRAATVSFPYSPRPAALAAGARASRVSPVVVAAGGGHQRLMGSLTNTQGLRFGVVVARFNEIVTNLLLQGA LETFERYSVKKENITVVSVPGSFEIPVAAQKLGKSGKFDAILCIGAVIRGDTTHYDAVANSAASGVLSAGLSAEIPCIFGVLTCDDMDQALNRAGGKAGN KGAEAALTAIEMASLFQHHLA |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | No | ||||