RGAP LOCUS ID | LOC_Os04g39970 | ||||
RAP-DB ID | Os04g0475500 | ||||
Function | vacuolar sorting protein 9 domain-containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.255 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.38 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 63.16 | ||||
confidence value | 0.18 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsV4 | ||||
Function assigned as per literature | OsV4 plays an important role during early chloroplast development under cold stress in rice | ||||
Subcellular localization as per literature | chloroplast | ||||
Cells used for localization experiment | tobacco cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 24289830 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/jipb.12138 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.158 | ||||
NLS score | -0.04 | ||||
Protein Sequence | >LOC_Os04g39970.1 protein MRDRSKNRKPTQRGRYLSTEAIQAVQSLKRAALRGSPSAAAAAVPVEPKLRRLLKADMVAVFRELAAQGEALLALQVFEEIRKEHWYKPKLLLYVDIVTV LASKGLRSEVDKVCSYLKREQLEPDTEGFNVLLKALLDAEFTQLTMDCFRLMKLWDSDPDRITYRTLIKGLESLGEMGLSADIKLEAQNDYGDLDFLDEE EMIDTLEQKSIWRGSSLIAENRRARISS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |