RGAP LOCUS ID | LOC_Os04g39080 | ||||
RAP-DB ID | Os04g0464966 | ||||
Function | OsFBX140 - F-box domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.102 | ||||
3) NUCPRED Prediction |
|||||
localization | Nuclear | ||||
score | 0.84 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 95.06 | ||||
confidence value | 0.89 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | MOF | ||||
Function assigned as per literature | MEIOTIC F-BOX (MOF)Is Essential for Male Meiotic DNA Double-Strand Break Repair in Rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Meiocyte Cells of the Complemented Transgenic Line | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 27436711 | ||||
Reference of localization | http://www.plantcell.org/content/28/8/1879.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 3 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.141 | ||||
NLS score | 1.07 | ||||
Protein Sequence | >LOC_Os04g39080.1 protein MRRERDATQIPENPMEGIPQTAAAAAAAAAAEASEPPRKRARVDGGGGGAGEEEEDRLSDLPDCLLEDILAHLGSRQAVQTSVLSRRWRNLWRGVRVVVI DVGSFRLPGADGDPPRFRLDRIEDFADGVLSPSLHPGAARELDALRMRLDEDAVTTNFQRWIRRALWRRPATVDLYYLPRRSFSWPPAVPLTPVTAVSRL KTLRIFGLRPTVVFGADEFPALEDLHIERCSYAHGTIASPTLKRLALVSPINGCFVREQRLTAPGLTSLRLVLPYSREEGVRVITDAPLTSLVDASITIV DTDPGDPRNRRVNQFKVDFLVAISNLLGRLTSVRNLDLTGLNATALLDNKSQEFPMFPYLTTLLLNECDIGYKYHVLRSILQNAPNLEQLRLHNCKFVGK SRRKAGQTQSKEKTSKCSSSTLSSACSSLKSVEIKHPRGEPSHDLLHEFLKEIPHNQWRKRSIDEETISIELNRK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |