 
    | RGAP LOCUS ID | LOC_Os04g32550 | ||||
| RAP-DB ID | Os04g0397000 | ||||
| Function | defender against cell death 1, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | chlo | ||||
| score | 4 | ||||
| 2) CELLO Prediction | |||||
| localization | PlasmaMembrane | ||||
| score | 3.161 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.93 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | DAD-1|DAD1 | ||||
| Function assigned as per literature | |||||
| Subcellular localization as per literature | NA | ||||
| Cells used for localization experiment | |||||
| NUCLEAR or Not Nuclear | |||||
| PMID | |||||
| Reference of localization | |||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.079 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os04g32550.1 protein MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVL CNLVLHLVIMNFLG | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| Presence of Splice variants | No | ||||