RGAP LOCUS ID | LOC_Os04g23550 | ||||
RAP-DB ID | Os04g0301500 | ||||
Function | basic helix-loop-helix family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.418 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.54 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.97 | ||||
confidence value | 0.95 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | bHLH | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | RERJ1|OsOsbHLH006 | ||||
Function assigned as per literature | regulates stress-inducible gene expression, with a strong correlation to JA accumulation in the stressed region. | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 22456953 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs00709-012-0400-z | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.094 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os04g23550.1 protein MDAEMAMGESFAYYWETQRYLESEELDSMYLPTQDDSNYESSSPDGSHSSSAPAPAAVGGDAAAAVAGSGGGMTTMMMGGGGGGGDDAGGANKNILMERD RRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREVAALESAAAASAAPAAANPFAGLGADEEHEYGHHHPSSSSERTKKVKRALSV SSISDALLAAAAPAPPVEIQELRVSEVGDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLFVEVDHMDSVQMKQMVEAALSQLVA TGSPLSSMSY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | YES |