RGAP LOCUS ID | LOC_Os04g11830 | ||||
RAP-DB ID | Os04g0194600 | ||||
Function | TCP family transcription factor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.528 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.19 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 9 | ||||
confidence value | 0.52 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | TCP | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | PCF1 | ||||
Function assigned as per literature | |||||
Subcellular localization as per literature | NA | ||||
Cells used for localization experiment | |||||
NUCLEAR or Not Nuclear | |||||
PMID | |||||
Reference of localization | |||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.082 | ||||
NLS score | 0.21 | ||||
Protein Sequence | >LOC_Os04g11830.1 protein MMASSSDLILYNLVPAQPLNPSAIPNPNPDLSIAAAEPPSSDGATPRRVRPRKSPSSSDRHSKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWL LRQAEPSIIAATGTGVTPEEAPPAAVAIGSSSVAAAAAAGGHGGAFVHVPYYTALLMQPPNADEPPMASAASASGTTAADENNN |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |