LOC_Os03g61570
| RGAP LOCUS ID | LOC_Os03g61570 |
| RAP-DB ID | Os03g0831200 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | extr |
| score | 6 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 1.425 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.27 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 8 |
| confidence value | 0.08 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | C2C2-GATA |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsGATA12 |
| Function assigned as per literature | OsGATA12 expression regulates chlorophyll levels, senescence and yield parameters in rice |
| Subcellular localization as per literature | Nucleus |
| Cells used for localization experiment | rice protoplasts |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 28342018 |
| Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-017-0604-x |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 1 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.119 |
| NLS score | -0.16 |
| Protein Sequence | >LOC_Os03g61570.1 protein MAPWLGGFLTLDLWVAGEWVDRSGRAHGLRRAQGVHRLPHHQDSALARRPLRPQGEMRSDLLLLLFPFSICAFFSPGFSVVDPPDLCFFFCFDPVAVQRV RDPVPEEETGGAGARRRRGRRGAAGEEEEQEGERGGGDHGAPHGGVREGGGPEAAAADAAEETPRRGGEGGHPPHGPLLRSHLRLNHHPTYLPT |
GO Analysis |
|
| Presence of Splice variants | YES |