RGAP LOCUS ID | LOC_Os03g55610 | ||||
RAP-DB ID | Os03g0764900 | ||||
Function | dof zinc finger domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.211 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.45 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.06 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | C2C2-Dof | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | SP3|OsDOF15 | ||||
Function assigned as per literature | SP3 regulates panicle architecture by modulating cytokinin homeostasis | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | rice protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30302902 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/abs/10.1111/jipb.12729 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.061 | ||||
NLS score | -0.22 | ||||
Protein Sequence | >LOC_Os03g55610.1 protein MIQELLGGTTMDQLKGASALNHASLPVVLQPIVSNPSPTSSSSTSSRSSAQATQQRSSSATSSPHGQGQGGGAAEQAPLRCPRCNSSNTKFCYYNNYNLT QPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRPMPAPVAKPPMSCKAAPPLGLGGGPVSWASGQQAATAHLMALLNSARGVQGHGGSNVHRLLGLDTMGH LQILPGAPNGAGAGTAASLWPQSAPRPVTPPPPHMDSQLGMGTLGHHDVLSSLGLKLPSSASSSPAASYYSDQLHAVVSNAGRPQAPYDVATASLPCTTA VTSLPSALSSVSAAAPTSNTVGMDLPPVSLAAPEMQYWNGPAAMSVPWPDLPTPNGAFP |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | No |