| RGAP LOCUS ID | LOC_Os03g55290 | ||||
| RAP-DB ID | Os03g0760800 | ||||
| Function | GASR3 - Gibberellin-regulated GASA/GAST/Snakin family protein precursor, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | extr | ||||
| score | 7 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 4.403 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.2 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.95 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsGASR1 | ||||
| Function assigned as per literature | OsGASR1 is involved in cell proliferation in meristems and panicles development | ||||
| Subcellular localization as per literature | Apoplasm or cell wall | ||||
| Cells used for localization experiment | Onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 16905871 | ||||
| Reference of localization | https://www.jstage.jst.go.jp/article/ggs/81/3/81_3_171/_html/-char/en | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.14 | ||||
| NLS score | 0.03 | ||||
| Protein Sequence | >LOC_Os03g55290.1 protein MKLNTTTTLALLLLLLLASSSLQVSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGARKRPKCP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | No | ||||