RGAP LOCUS ID | LOC_Os03g52690 | ||||
RAP-DB ID | Os03g0737000 | ||||
Function | CBS domain containing membrane protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cysk | ||||
score | 5 | ||||
2) CELLO Prediction |
|||||
localization | Cytoplasmic | ||||
score | 1.421 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.07 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 9 | ||||
confidence value | 0.66 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsCBSX4 | ||||
Function assigned as per literature | OsCBSX4 has role in abiotic stress tolerance in plants | ||||
Subcellular localization as per literature | Plasma membrane | ||||
Cells used for localization experiment | onion epidermal peel | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 22302312 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs12033-011-9487-2 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.113 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g52690.1 protein MMVCGSVLHPDFQSSSQAHDFVGVKMQRAIQAIGSHGSLLKSAVLRHISAPKPSILPAVYSRSMSVSSAQIEESGFETATVADILKSKGKSADGSWLWCT TDDSVYDAVKSMTQHNVGALVVVKPGQDKSIAGIVTERDYLRKIIVQGRSSKSTKVGDIMTEENQLITVKPDTRVLQAMQLMTEKRIRHIPVIDGTGMVG MVSIGDIVRAVVSEHREELNRLNAYIQGGY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | YES |