RGAP LOCUS ID | LOC_Os03g52320 | ||||
RAP-DB ID | Os03g0733600 | ||||
Function | GRF-interacting factor 1, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.31 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.33 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 39 | ||||
confidence value | 0.06 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | MKB3 | ||||
Function assigned as per literature | OsGIF1 is involved in the regulation of floral organ development | ||||
Subcellular localization as per literature | OsGIF1 interact with GRF6 and GRF10 in the nucleus | ||||
Cells used for localization experiment | Tobacco epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 24596329 | ||||
Reference of localization | http://www.plantphysiol.org/content/165/1/160 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.044 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g52320.1 protein MQQQHLMQMNQGMMGGYASPTTVTTDLIQQYLDENKQLILAILDNQNNGKVEECARNQAKLQHNLMYLAAIADSQPPQTAAMSQYPSNLMMQSGARYMPQ QSAQMMAPQSLMAARSSMMYAQPALSPLQQQQQQQAAAAHGQLGMGSGGTTSGFSILHGEASMGGGGGGGGAGNSMMNAGVFSDFGRGGGGGGKEGSTSL SVDVRGANSGAQSGDGEYLKGTEEEGS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |