RGAP LOCUS ID | LOC_Os03g51690 | ||||
RAP-DB ID | Os03g0727000 | ||||
Function | Homeobox domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.852 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.69 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.24 | ||||
confidence value | 0.69 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | HB/TALE | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OSH1|Oskn1 | ||||
Function assigned as per literature | OSH1 functions in shoot apical meristem maintenance in rice | ||||
Subcellular localization as per literature | Nucleus and cytoplasmic strands and also in small vesicle-like structures in the cytoplasm | ||||
Cells used for localization experiment | Onion epidermal peels, Rice suspension cells, Rice epidermal leaf cells and root hairs of stably transformed Arabidopsis seedlings | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 15604716 | ||||
Reference of localization | https://link.springer.com/article/10.1007/s11103-004-1967-3 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 3 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.097 | ||||
NLS score | 0.34 | ||||
Protein Sequence | >LOC_Os03g51690.2 protein MEEISHHFGVVGASGVHGGHQHQHHHHPWGSSLSAIVAPPPPPQLQQQQTQAGGMAHTPLTLNTAAAAVGNPVLQLANGSLLDACGKAKEASASASYAAD VEAIKAKIISHPHYSSLLAAYLDCQKVGAPPEVAARLTAVAQDLELRQRTALGVLGAATEPELDQFMEAYHEMLVKYREELTRPLQEAMEFLRRVETQLN TLSISGRSLRNILSSGSSEEDQEGSGGETELPEIDAHGVDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLNWWELHYKWPYPSESQKVAL AESTGLDLKQINNWFINQRKRHWKPSDEMQFVMMDGYHPTNAAAFYMDGHFINDGGLYRLG |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
7 |
|
||||
Presence of Splice variants | YES |