RGAP LOCUS ID | LOC_Os03g47800 | ||||
RAP-DB ID | Os03g0681900 | ||||
Function | RNA recognition motif containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 10 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.269 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.25 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 43.61 | ||||
confidence value | 0.09 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsRZ3 | ||||
Function assigned as per literature | OsRZ3 may play a role in cold adaptation process during cold stress conditions | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Roots of OsRZ3-expressing Arabidopsis plants | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 20088860 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-3040.2009.02101.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.182 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g47800.1 protein MAGKEEGRIFVGGLSFHTDERKLADAFRRFGKVVDAQIMLERHTQRHRGFGFVTFSDPEAVDSAIKEMHCQELDGRTISVNKAEPKMNTDDTRYESGGGR GEYRGGRGDGPPPGNCFECGRAGHWARDCPNPGGGRSARYSSSKFSAGGRGDRFSGSDRFGDRYMDDRYDGGYREPVDVRDRYGGGRDRYANDRYPSGGD RYVPDRYGGPDRYQPSSYGRERERSYERDGVRGNGGYDRSGPRGGGSYDRDGPRGGISGGYDRDGPRGGGVDRYGGGGPARYDGGSYRDRSGPYDRPSRG GRFDDRFQ |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | No |