RGAP LOCUS ID | LOC_Os03g45400 | ||||
RAP-DB ID | Os03g0656900 | ||||
Function | antitermination NusB domain-containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Chloroplast | ||||
score | 3.184 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.1 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 9 | ||||
confidence value | 0.76 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsNUS1|V1 | ||||
Function assigned as per literature | NUS1 is involved in the regulation of chloroplast RNA metabolism and promotes the establishment of the plastid genetic system during early chloroplast development under cold stress conditions | ||||
Subcellular localization as per literature | Chloroplast | ||||
Cells used for localization experiment | Guard cells and protoplasts isolated from mature leaves of transgenic Arabidopsis plants | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 21981410 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/j.1365-313X.2011.04755.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.118 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g45400.1 protein MEATGAAVSAFSTASSSSPAAPRHGRLLASPAAWRSARTLPPRAVASSRATVLVSNPPPPPLPPTPAPAAVAPSKVDRSGRFCSPRAARELALMISYAAC LEGADVVRLFDRRISARREPGYVFDKACVVNYNHMSFGGGPLEVGTEEEAEKLMSQNEKDSANEAEVLSAPPKLVYNNFVLRLAREILVAVASGWDKHVD IINKITPQNWKDEPVARILELCILHIAMAEMTSKGTPHKIVINEAVDLAKRFCDGGAPRVINGCLRTFVKDHMNIDTSQPAPAESKA |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |