| RGAP LOCUS ID | LOC_Os03g40920 | ||||
| RAP-DB ID | Os03g0606200 | ||||
| Function | expressed protein | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 9 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.053 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.7 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 4 | ||||
| confidence value | 0.05 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | RMtATP6 | ||||
| Function assigned as per literature | RMtATP6 protein acts as a subunit of ATP synthase, and is expressed in response to salt and osmotic stresses. | ||||
| Subcellular localization as per literature | Mitochondria | ||||
| Cells used for localization experiment | Tobacco protoplasts and yeast strain INVSc1 | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 16317034 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/57/1/193/442103 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 6 | ||||
| Number of PAT7 | 3 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.228 | ||||
| NLS score | 3.41 | ||||
| Protein Sequence | >LOC_Os03g40920.1 protein MAVELELFQKDSKGRFPWGPTKIWPTWRRGEAHLHAAAPLPNPKRDAITTTTIRFFPLRIEKKAKGPLDPPTTPRPPRRRRKRRRSRMFFSRFDPWPVFF RREWKRCWPFLTGFAVTGAIITKMTAGFTEEDLKNSKFVQAHKKH |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| Presence of Splice variants | No | ||||