LOC_Os03g37960
| RGAP LOCUS ID | LOC_Os03g37960 |
| RAP-DB ID | Os03g0576600 |
| Function | acyl CoA binding protein, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | cyto |
| score | 8 |
2) CELLO Prediction |
|
| localization | Mitochondrial |
| score | 2.007 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.12 |
4) Y-Loc Prediction |
|
| localization | Cytoplasm |
| score | 70 |
| confidence value | 0.26 |
| Number Of Software Predicting Nucleus | 0 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsACBP3 |
| Function assigned as per literature | Rice Acyl-CoA-binding proteins (ACBPs) are known to bind and transport acyl-CoA esters and phospholipids intracellularly |
| Subcellular localization as per literature | Cytosol |
| Cells used for localization experiment | transgenic Arabidopsis (Arabidopsis thaliana) |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 24926784 |
| Reference of localization | https://www.tandfonline.com/doi/pdf/10.4161/psb.29544?needAccess=true |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.155 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os03g37960.1 protein MSDYITKVKQLQEEAAALKAVFRAYLVGEMNIFECHIGRLTRCRRGFRTQMKKQIVYSPGTREMNLLSLIKPSLAHVGYCSTYG |
GO Analysis |
|
| Presence of Splice variants | No |