RGAP LOCUS ID | LOC_Os03g33090 | ||||
RAP-DB ID | Os03g0445700 | ||||
Function | DUF260 domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 1.388 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.05 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 4 | ||||
confidence value | 0.04 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | LBD | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | Os-LBD37 | ||||
Function assigned as per literature | OsLBD37 may function as a novel regulators of heading date and crop yield in rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Rice leaf protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 28342864 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0006291X17305752 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 1 | ||||
Basic residues % | 0.093 | ||||
NLS score | 0.18 | ||||
Protein Sequence | >LOC_Os03g33090.1 protein MSCNGCRVLRKGCSDGCVLRPCLQWIDAADAQGHATVFVAKFFGRAGLLSFISAVPEAQRPALFQSLLYEAAGRTINPVHGAVGLLWTGNWPLCQAAVET VLRGGAIGPLPELGGACGGAGGDLYGAAKRNGGWSTFSTAKRVRKAEVPEAPSCDLGLCLSPGSPPAVGERKPALRPGTPSMSSDESGTTTGGERDPVLL NLFV |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | No |