| RGAP LOCUS ID | LOC_Os03g27390 |
| RAP-DB ID | Os03g0391700 |
| Function | CPuORF35 - conserved peptide uORF-containing transcript, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | Nuclear |
| score | 10 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 4.104 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.58 |
4) Y-Loc Prediction |
|
| localization | Nuclear |
| score | 99.87 |
| confidence value | 0.84 |
| Number Of Software Predicting Nucleus | 3 |
| Seed Specific | No |
| Transcription factor category | bHLH |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsbHLH138 |
| Function assigned as per literature | OsbHLH138 regulates thermosensitive genic male sterility in rice via activation of TMS5. |
| Subcellular localization as per literature | Nucleus |
| Cells used for localization experiment | Rice protoplasts |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 30778635 |
| Reference of localization | https://link.springer.com/article/10.1007%2Fs00122-019-03310-7 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 4 |
| Number of PAT7 | 2 |
| Number of Bipartite | 0 |
| Basic residues % | 0.102 |
| NLS score | 1.58 |
| Protein Sequence | >LOC_Os03g27390.2 protein MGEKVNPWCHWSNPPWTESSANNLHPPDVSLDNTNSVALPTYLNSDGYIYSGVAASMPSIAASVTDRPVSFSSRFVTTLVPSVGLSTAETLRKRPLVFFH NVNNTFTVGPLLSKGTLDTVPELQGSNETNVTDVGAQNTECMHENTEEIDALLCSDSDEGCLKVQELNNRVRKYPMQNDTMSVESVASAGASQPAKKRRL SSGTDRSVVDTASSARPDHSVDQKHLSHDDDAQSCCIGEVESDHQFALREGEEAEGDDGPDDRKRRRERIQETVAALRKIVPGGIAKDATAVLDEAICYL KYLKLKVKTLGAVSL |
GO Analysis |
|
| Presence of Splice variants | YES |