RGAP LOCUS ID | LOC_Os03g25390 | ||||
RAP-DB ID | Os03g0369800 | ||||
Function | novel plant SNARE 11, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 7 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.869 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.44 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 71.99 | ||||
confidence value | 0.91 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsNPSN12 | ||||
Function assigned as per literature | OsNPSNs are involved in different aspects of the signal transduction in plant and yeast responses to abiotic stresses | ||||
Subcellular localization as per literature | plasma membrane | ||||
Cells used for localization experiment | onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 18197419 | ||||
Reference of localization | https://link.springer.com/article/10.1007/s00438-007-0313-2 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.117 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g25390.2 protein MASDVPMSPELEQIDGEVQDIFRALQNGFQKMDKIKDSSRQAKQLEDLTAKMKECKRLIKEFDRILKDEESNNPPEVHKQLNDRKQYMIKELNSYVTLRK TYQSSLGNNNKRVELFDMGAGSSEPAAEDNIQIASAMTNQQLMDAGREQMTQTDQAIDRSKMVVAQTIETGTQTASALSQQVSFSTLHTIQDFPVTCLFW QSGILVCLVCNLVQQISFALQTEQMKRIGNELDTVHFSLKKASQLVKEIGRQVATDKCIMALLFLIVCGVIAIIVVKIVNPHNKNIRDIPGLAPPAQNFQ ISNRRLLSVEIIRGL |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | YES |