| RGAP LOCUS ID | LOC_Os03g22890 | ||||
| RAP-DB ID | Os03g0352400 | ||||
| Function | GTPase of unknown function domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.892 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.58 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 80.85 | ||||
| confidence value | 0.1 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsNug2 | ||||
| Function assigned as per literature | Nug2/Nog2p GTPase from mono- and didicotyledonous plants is linked to the pre-60S ribosome complex and actively processed 27S into 25S during the ribosomal large subunit maturation process, i.e. prior to export to the cytoplasm | ||||
| Subcellular localization as per literature | nucleus | ||||
| Cells used for localization experiment | rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 21205822 | ||||
| Reference of localization | http://www.jbc.org/content/286/10/8620.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 3 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.168 | ||||
| NLS score | 0.77 | ||||
| Protein Sequence | >LOC_Os03g22890.2 protein MAKKKERAVNVSGKPRHSLDVNRANDKKGAGGGAGGGGGGRSAATVRRLKMYKMRPLRDRGGKILKHDLQSKELPNTRIEPDRRWFGNTRVVNQKELEFF REELQSRLSNNYNVILKERKLPLSLLQDHQKQARAHLLDTEPFEHAFGPKGKRKRPKLMALDYESLLKKADDSQGAFEDKHATAKLLKEEEEDGLRDLVR HTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRCYHLEKHLKENAKHKHLVFLLNKCDLVPAWATKGWLRTLSKDYPTLAFHASINSSFGKGSL LSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRSKSVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQNNDSETDIVLKGVVRVTNLADASEHI GEVLRRVKKEHLKRAYKIEDWVDDNDFLVQLSKTTGKLLRGGEPDLTTTAKMVLHDWQRGKIPFFVPPPQQGEDSPSETAEPVEKSDEEGVSSDRTAAAM KAIAGIISSQQQMNVPCQKEFGVTNEDSEVAEQSE |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | YES | ||||