RGAP LOCUS ID | LOC_Os03g21800 | ||||
RAP-DB ID | Os03g0336200 | ||||
Function | bZIP transcription factor family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.549 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.59 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 1 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | bZIP | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | RF2b|OsbZIP30 | ||||
Function assigned as per literature | RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | tobacco BY-2 protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 14704272 | ||||
Reference of localization | https://www.pnas.org/content/101/2/687.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 1 | ||||
Basic residues % | 0.122 | ||||
NLS score | 0.45 | ||||
Protein Sequence | >LOC_Os03g21800.1 protein MQEPKHTDPAAMRGAHHRRARSEVAFRLPDDLDLGGGGAGAFDEIGSEDDLFSTFMDIEKISSGPAAAGGSDRDRAAETSSPPRPKHRHSSSVDGSGFFA AARKDAAASLAEVMEAKKAMTPEQLSELAAIDPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTGLSAENAELKIRLQ AMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMGLQHVPYNTPFFPLAQHNAARQNGGTQLPPQFQPPRPNVPNHMLSHPNGLQDIMQQDPLGR LQGLDISKGPLVVKSESSSISASESSSTF |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
Presence of Splice variants | YES |