RGAP LOCUS ID | LOC_Os03g20680 | ||||
RAP-DB ID | Os03g0322900 | ||||
Function | late embryogenesis abundant protein 1, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 4 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 1.195 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.35 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 93.53 | ||||
confidence value | 0.15 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsLEA3-2 | ||||
Function assigned as per literature | OsLEA3-2 plays an important role in tolerance to abiotic stresses | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | onion epidermis cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 23024799 | ||||
Reference of localization | http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0045117 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.186 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g20680.1 protein MASRQDRREARAEADARRAAEEIARARDERVMQAEVDARSAADEIARARADRGAATMGADTAHHAAGGGGILESVQEGAKSFVSAVGRTFGGARDTAAEK TSQTADATRDKLGEYKDYTADKARETNDSVARKTNETADASRDKLGEYKDYTADKTRETKDAVAQKASDASEATKNKLGEYKDALARKTRDAKDTTAQKA TEFKDGVKATAQETRDATADTARKAKDATKDTTQTAADKARETAATHDDATDKGQGQGLLGALGNVTGAIKEKLTVSPAATQEHLGGGEERAVKERAAEK AASVYFEEKDRLTRERAAERVDKCVEKCVEGCPDATCAHRHGKM |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |