| RGAP LOCUS ID | LOC_Os03g20370 | 
                        
                            | RAP-DB ID | Os03g0319300 | 
                        
                            | Function | OsCam1-1 - Calmodulin, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | cyto | 
                        
                            | score | 4 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | Cytoplasmic | 
                        
                            | score | 3.154 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.03 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Cytoplasm | 
                        
                            | score | 88 | 
                        
                            | confidence value | 0.7 | 
                        
                            | Number Of Software Predicting Nucleus | 0 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category |  | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | OsCam1-1 | 
                        
                            | Function assigned as per literature | OsCam1-1 mediates downstream HS-related gene expression for the acquisition of thermotolerance in rice. | 
                        
                            | Subcellular localization as per literature | Nucleus | 
                        
                            | Cells used for localization experiment | Arabidopsis protoplasts | 
                        
                            | NUCLEAR or Not Nuclear | NUCLEAR | 
                        
                            | PMID | 22428987 | 
                        
                            | Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/j.1365-3040.2012.02508.x | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 0 | 
                        
                            | Number of PAT7 | 0 | 
                        
                            | Number of Bipartite | 0 | 
                        
                            | Basic residues % | 0.101 | 
                        
                            | NLS score | -0.47 | 
                        
                            | Protein Sequence | >LOC_Os03g20370.1 protein MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGF
 ISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | protein binding |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | binding |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | signal transduction |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | post-embryonic development |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to abiotic stimulus |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biological_process |  | 
                                                        
                            | Presence of Splice variants | No |